PDB entry 2sam

View 2sam on RCSB PDB site
Description: structure of the protease from simian immunodeficiency virus: complex with an irreversible non-peptide inhibitor
Class: hydrolase(acid protease)
Keywords: hydrolase(acid protease)
Deposited on 1994-07-08, released 1994-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: siv protease
    Species: Simian immunodeficiency virus [TaxId:11723]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88016 (0-97)
      • conflict (3)
      • conflict (6)
    Domains in SCOPe 2.07: d2sama_
  • Heterogens: EPN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2samA (A:)
    pqfhlwkrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
    nveievlgkrikgtimtgdtpinifgrnlltalgmslnf