PDB entry 2rvn

View 2rvn on RCSB PDB site
Description: solution structure of the chromodomain of hp1a with the phosphorylated n-terminal tail complexed with h3k9me3 peptide
Deposited on 2015-12-18, released 2016-03-16
The last revision was dated 2016-03-16, with a file datestamp of 2016-03-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromobox protein homolog 5
    Species: Mus musculus [TaxId:10090]
    Gene: CBX5, HP1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q61686 (3-82)
      • expression tag (0-2)
  • Chain 'B':
    Compound: 18-mer peptide of Histone H3
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RVN (0-17)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rvnA (A:)
    gshmgkktkrtadssssedeeeyvvekvldrrmvkgqveyllkwkgfseehntwepeknl
    dcpelisefmkkykkmkegennk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2rvnB (B:)
    artkqtarkstggkapry