PDB entry 2rvl

View 2rvl on RCSB PDB site
Description: solution structure of the chromodomain of hp1alpha with the n-terminal tail
Deposited on 2015-12-18, released 2016-03-16
The last revision was dated 2016-03-16, with a file datestamp of 2016-03-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromobox protein homolog 5
    Species: Mus musculus [TaxId:10090]
    Gene: CBX5, HP1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q61686 (3-82)
      • expression tag (0-2)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rvlA (A:)
gshmgkktkrtadssssedeeeyvvekvldrrmvkgqveyllkwkgfseehntwepeknl
dcpelisefmkkykkmkegennk