PDB entry 2rvk

View 2rvk on RCSB PDB site
Description: refined solution structure of schizosaccharomyces pombe sin1 crim domain
Deposited on 2015-12-10, released 2017-01-25
The last revision was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stress-activated map kinase-interacting protein 1
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Gene: sin1, SPAPYUG7.02c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P7Y9 (6-159)
      • expression tag (0-5)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rvkA (A:)
gpghmgsvsnakaptsalrallehkenssqngplaenfatfsghaesnalrlniyfpsse
spskplfvelrknvlvseaigyillqyvnqqlvppiedeaqnpnywnlriveddgelded
fpaldrvgplskfgfdafalvkatpaqikenqaaypfksk