PDB entry 2rvj

View 2rvj on RCSB PDB site
Description: NMR structure of Epithelial splicing regulatory protein 1
Class: transcription
Keywords: transcription
Deposited on 2015-10-23, released 2015-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epithelial splicing regulatory protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ESRP1, RBM35A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NXG1 (0-101)
      • engineered mutation (0)
      • expression tag (102-103)
    Domains in SCOPe 2.08: d2rvja1, d2rvja2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rvjA (A:)
    mpptnvrdcirlrglpyaatiedildflgefatdirthgvhmvlnhqgrpsgdafiqmks
    adrafmaaqkchkknmkdryvevfqcsaeemnfvlmggtlnrle