PDB entry 2rvh

View 2rvh on RCSB PDB site
Description: nmr structure of eif1
Deposited on 2015-10-16, released 2016-10-26
The last revision was dated 2017-05-31, with a file datestamp of 2017-05-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Eukaryotic translation initiation factor eIF-1
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: SUI1, RFR1, YNL244C, N0905
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rvhA (A:)
    msienlksfdpfadtgddetatsnyihiriqqrngrktlttvqgvpeeydlkrilkvlkk
    dfacngnivkdpemgeiiqlqgdqrakvcefmisqlglqkknikihgf