PDB entry 2rvf

View 2rvf on RCSB PDB site
Description: Solution NMR structure of Monosiga brevicollis CRK/CRKL homolog (crka1) SH2 domain
Class: signaling protein
Keywords: signal transduction, phosphotyrosine-binding domain, SIGNALING PROTEIN
Deposited on 2015-09-24, released 2016-09-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Predicted protein
    Species: Monosiga brevicollis [TaxId:81824]
    Gene: 25438, crka1
    Database cross-references and differences (RAF-indexed):
    • PDB 2RVF (0-103)
    Domains in SCOPe 2.08: d2rvfa1, d2rvfa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rvfA (A:)
    gssgssgmaeaaapwyhgplsrtdaensllrmpegtflvrdstsspgdyvlscsengkvt
    hyklsaeegkiridthlfdnldaaitfymeheleysslkqplqr