PDB entry 2rvc

View 2rvc on RCSB PDB site
Description: solution structure of zalpha domain of goldfish zbp-containing protein kinase
Deposited on 2015-07-08, released 2016-02-03
The last revision was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interferon-inducible and double-stranded-dependent eIF-2kinase
    Species: Carassius auratus [TaxId:7957]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rvcA (A:)
    msaetqmerkiidflrqngksialtiakeigldkstvnrhlynlqrsnqvfnsnekppvw
    dlme