PDB entry 2rvb

View 2rvb on RCSB PDB site
Description: Solution structure of the complex between XPC acidic domain and TFIIH p62 PH domain
Class: DNA binding protein/transcription
Keywords: DNA REPAIR, HUMAN XPC, ACIDIC DOMAIN, GENERAL TRANSCRIPTION FACTOR, HUMAN TFIIH P62, PH DOMAIN, DNA BINDING PROTEIN-TRANSCRIPTION complex
Deposited on 2015-07-01, released 2015-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair protein complementing XP-C cells
    Species: Homo sapiens [TaxId:9606]
    Gene: XPC, XPCC
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: General transcription factor IIH subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GTF2H1, BTF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rvbb_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rvbB (B:)
    gsmatsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispe
    gkakiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rvbB (B:)
    matsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispegk
    akiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan