PDB entry 2rv7

View 2rv7 on RCSB PDB site
Description: solution structures of the dna-binding domains (zf3-zf4-zf5) of immune-related zinc-finger protein zfat
Deposited on 2015-01-26, released 2015-04-08
The last revision was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger protein ZFAT
    Species: Homo sapiens [TaxId:9606]
    Gene: ZFAT, KIAA1485, ZFAT1, ZNF406
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P243 (7-91)
      • expression tag (0-6)
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rv7A (A:)
    gssgssgkpykcpqcsyasaikanlnvhlrkhtgekfacdycsftclskghlkvhiervh
    kkikqhcrfckkkysdvknlikhirdahdpqd