PDB entry 2rv6

View 2rv6 on RCSB PDB site
Description: Solution structures of the DNA-binding domains (ZF2-ZF3-ZF4) of immune-related zinc-finger protein ZFAT
Class: transcription
Keywords: ZFAT, zinc finger, TRANSCRIPTION
Deposited on 2015-01-26, released 2015-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger protein ZFAT
    Species: Homo sapiens [TaxId:9606]
    Gene: ZFAT, KIAA1485, ZFAT1, ZNF406
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P243 (7-91)
      • expression tag (0-6)
    Domains in SCOPe 2.06: d2rv6a1, d2rv6a2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rv6A (A:)
    gssgssgkiftceycnkvfkfkhslqahlrihtnekpykcpqcsyasaikanlnvhlrkh
    tgekfacdycsftclskghlkvhiervhkkik