PDB entry 2ruq

View 2ruq on RCSB PDB site
Description: solution structure of human Pin1 PPIase mutant C113A
Class: isomerase
Keywords: Cys-113 mutation, Human Pin1 PPIase, ISOMERASE
Deposited on 2015-01-20, released 2016-01-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-01-06, with a file datestamp of 2015-12-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
  Species: Homo sapiens [TaxId:9606]
  Gene: PIN1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13526 (4-116)
    • expression tag (0-3)
    • engineered mutation (66)
  Domains in SCOPe 2.08: d2ruqa1, d2ruqa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ruqA (A:)
  gshmeparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfesl
  asqfsdassakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte