PDB entry 2rup

View 2rup on RCSB PDB site
Description: solution structure of rat p2x4 receptor head domain
Deposited on 2014-11-12, released 2015-02-04
The last revision was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p2x purinoceptor 4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: P2rx4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51577 (1-57)
      • expression tag (0)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rupA (A:)
mqtqstcpeipdktsicnsdadctpgsvdthssgvatgrcvpfnesvktcevaawcpv