PDB entry 2ruk
View 2ruk on RCSB PDB site
Description: Solution structure of the complex between p53 transactivation domain 2 and TFIIH p62 PH domain
Class: transcription
Keywords: antitumor protein, general transcription factor, ph domain, transcription
Deposited on
2014-09-24, released
2014-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated
2014-10-15, with a file datestamp of
2014-10-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cellular tumor antigen p53
Species: Homo sapiens [TaxId:9606]
Gene: TP53
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: General transcription factor IIH subunit 1
Species: Homo sapiens [TaxId:9606]
Gene: BTF2, GTF2H1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2rukb_
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence, based on SEQRES records: (download)
>2rukB (B:)
gsmatsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispe
gkakiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan
Sequence, based on observed residues (ATOM records): (download)
>2rukB (B:)
matsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispegk
akiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan