PDB entry 2ruk

View 2ruk on RCSB PDB site
Description: Solution structure of the complex between p53 transactivation domain 2 and TFIIH p62 PH domain
Class: transcription
Keywords: antitumor protein, general transcription factor, ph domain, transcription
Deposited on 2014-09-24, released 2014-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-10-15, with a file datestamp of 2014-10-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: General transcription factor IIH subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BTF2, GTF2H1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rukb_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rukB (B:)
    gsmatsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispe
    gkakiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rukB (B:)
    matsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispegk
    akiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan