PDB entry 2ruj

View 2ruj on RCSB PDB site
Description: solution structure of mtsl spin-labeled schizosaccharomyces pombe sin1 crim domain
Deposited on 2014-07-24, released 2015-07-29
The last revision was dated 2015-07-29, with a file datestamp of 2015-07-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stress-activated map kinase-interacting protein 1
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Gene: sin1, SPAPYUG7.02c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P7Y9 (6-159)
      • expression tag (0-5)
      • engineered mutation (39)
      • engineered mutation (41)
      • engineered mutation (50)
      • engineered mutation (60)
      • engineered mutation (71)
      • engineered mutation (91)
      • engineered mutation (130)
      • engineered mutation (143)
      • engineered mutation (153)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rujA (A:)
gpghmgsvsnakaptsalrallehkenssqngplaenfacfcghaesnalclniyfpsse
cpskplfvelrcnvlvseaigyillqyvnqqcvppiedeaqnpnywnlriveddgelded
fpaldrvgplckfgfdafalvkacpaqikenqacypfksk