PDB entry 2rui

View 2rui on RCSB PDB site
Description: solution structure of the bacillus anthracis sortase a-substrate complex
Deposited on 2014-06-22, released 2015-09-09
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LPXTG-site transpeptidase family protein
    Species: Bacillus anthracis str. Sterne [TaxId:260799]
    Gene: BAS0654, srtA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6I399 (4-157)
      • expression tag (0-3)
  • Chain 'B':
    Compound: Boc-LPAT*
    Species: synthetic, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RUI (0-4)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2ruiA (A:)
gshmdaskidqpdlaevanasldkkqvigrisipsvslelpvlkssteknllsgaatvke
nqvmgkgnyalaghnmskkgvlfsdiaslkkgdkiylydneneyeyavtgvsevtpdkwe
vvedhgkdeitlitcvsvkdnskryvvagdlvgtkakk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2ruiB (B:)
xlpax