PDB entry 2ruh

View 2ruh on RCSB PDB site
Description: Chemical Shift Assignments for MIP and MDM2 in bound state
Deposited on 2014-06-03, released 2014-10-15
The last revision was dated 2014-10-15, with a file datestamp of 2014-10-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (23-119)
      • expression tag (0-22)
      • expression tag (120-130)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2ruhA (A:)
mprfweywlrlmegggenlyfqgmsvptdgavttsqipaseqetlvrpkplllkllksvg
aqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgdlfgvpsfsvkehrkiytm
masmtggqqmg