PDB entry 2rud

View 2rud on RCSB PDB site
Description: Solution structure of the peptidyl prolyl cis-trans isomerase domain of C113D mutant human Pin1 with sulfate ion
Class: isomerase
Keywords: protein/cis-trans-isomerase, PPIase, ISOMERASE
Deposited on 2014-03-25, released 2014-12-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13526 (4-116)
      • expression tag (0-3)
      • engineered mutation (66)
    Domains in SCOPe 2.08: d2ruda1, d2ruda2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rudA (A:)
    gshmeparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfesl
    asqfsddssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte