PDB entry 2ru5

View 2ru5 on RCSB PDB site
Description: Designed Armadillo Repeat Protein Fragment (MAII)
Deposited on 2013-11-23, released 2014-07-23
The last revision was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Armadillo repeat protein C-terminal fragment
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RU5 (0-83)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2ru5B (B:)
    gneqiqavidagalpalvqllsspneqilqealwalsniasggneqkqavkeagalekle
    qlqshenekiqkeaqealeklqsh