PDB entry 2ru3

View 2ru3 on RCSB PDB site
Description: Solution structure of c.elegans SUP-12 RRM in complex with RNA
Class: RNA binding protein/RNA
Keywords: solution structure, Protein-RNA Complex, RRM (RNA recognition motif), RNA BINDING PROTEIN-RNA complex
Deposited on 2013-11-12, released 2014-08-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-18, with a file datestamp of 2015-03-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein SUP-12, isoform a
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: sup-12, CELE_T22B2.4, T22B2.4
    Database cross-references and differences (RAF-indexed):
    • Uniprot O45189 (1-102)
      • expression tag (0)
    Domains in SCOPe 2.07: d2ru3a1, d2ru3a2
  • Chain 'B':
    Compound: RNA (5'-r(*gp*up*gp*up*gp*c)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ru3A (A:)
    gstnaepvvgsrdtmftkifvgglpyhtsdktlheyfeqfgdieeavvitdrntqksrgy
    gfvtmkdrasaerackdpnpiidgrkanvnlaylgakprtnvq
    

  • Chain 'B':
    No sequence available.