PDB entry 2ru0

View 2ru0 on RCSB PDB site
Description: solution structure of actinomycesin
Deposited on 2013-10-17, released 2014-10-22
The last revision was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arthropod defensin
    Species: Actinomyces sp. oral taxon 171 [TaxId:706439]
    Gene: HMPREF9057_00043
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2ru0A (A:)
gfgcpwnayecdrhcvskgytggncrgkirqtchcy