PDB entry 2rtx

View 2rtx on RCSB PDB site
Description: Solution structure of the GGQ domain of YaeJ protein from Escherichia coli
Deposited on 2013-09-21, released 2013-12-25
The last revision was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-tRNA hydrolase YaeJ
    Species: Escherichia coli [TaxId:83333]
    Gene: yaeJ, b0191, JW0187
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40711 (0-108)
      • expression tag (109-120)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rtxA (A:)
mivisrhvaipdgeleitairaqgaggqhvnktstaihlrfdirasslpeyykerllaas
hhlissdgvivikaqeyrsqelnreaalarlvamikelttekkarrptrsgpssgenlyf
q