PDB entry 2rtu

View 2rtu on RCSB PDB site
Description: Solution structure of oxidized human HMGB1 A box
Class: DNA binding protein
Keywords: disulfide bond, High Mobility Group Box 1, DNA BINDING PROTEIN
Deposited on 2013-09-12, released 2014-03-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: High mobility group protein B1
  Species: Homo sapiens [TaxId:9606]
  Gene: HMGB1, HMG1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09429 (3-86)
    • expression tag (0-2)
  Domains in SCOPe 2.08: d2rtua1, d2rtua2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rtuA (A:)
  gshmgkgdpkkprgkmssyaffvqtcreehkkkhpdasvnfsefskkcserwktmsakek
  gkfedmakadkaryeremktyippkge