PDB entry 2rtt

View 2rtt on RCSB PDB site
Description: Solution structure of the chitin-binding domain of Chi18aC from Streptomyces coelicolor
Deposited on 2013-08-26, released 2014-08-27
The last revision was dated 2014-08-27, with a file datestamp of 2014-08-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ChiC
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: chiC
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rttA (A:)
    atsatatfaktsdwgtgfggswtvkntgttslsswtvewdfptgtkvtsawdatvtnsgd
    hwtaknvgwngtlapgasvsfgfngsgpgspsncklnggscdgts