PDB entry 2rth

View 2rth on RCSB PDB site
Description: streptavidin-glycoluril complex, ph 2.50, space group i222
Class: biotin-binding protein
Keywords: biotin-binding protein, streptavidin-glycoluril, ph 2.50, potassium acetate
Deposited on 1997-09-11, released 1998-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.203
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rthb_
  • Chain 'D':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rthd_
  • Heterogens: ACT, GLL, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rthB (B:)
    dpskdskaqvsaaeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgry
    dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanaw
    kstlvghdtftkvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rthB (B:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2rthD (D:)
    dpskdskaqvsaaeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgry
    dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanaw
    kstlvghdtftkvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rthD (D:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    v