PDB entry 2rt9

View 2rt9 on RCSB PDB site
Description: Solution structure of a regulatory domain of meiosis inhibitor
Deposited on 2013-07-05, released 2014-07-16
The last revision was dated 2015-01-21, with a file datestamp of 2015-01-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: F-box only protein 43
    Species: Mus musculus [TaxId:10090]
    Gene: Fbxo43
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2rt9A (A:)
gssgssgtdealkpcprcqspakyqphkkrglcsrlacgfdfcvlclcayhgsedcrrg

    Sequence, based on observed residues (ATOM records):
    >2rt9A (A:)
tdealkpcprcqspakyqphkkrglcsrlacgfdfcvlclcayhgsedcrrg