PDB entry 2rt3

View 2rt3 on RCSB PDB site
Description: Solution structure of the second RRM domain of Nrd1
Deposited on 2013-04-16, released 2014-04-16
The last revision was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Negative regulator of differentiation 1
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: NRD1
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rt3A (A:)
nsasnssvllavqqsgacrnvflgnlpngitedeiredlepfgpidqikivterniafvh
flniaaaikavqelplnpkwskrriyygrdrcavglk