PDB entry 2rsy

View 2rsy on RCSB PDB site
Description: Solution structure of the SH2 domain of Csk in complex with a phosphopeptide from Cbp
Class: transferase/signaling protein
Keywords: SH2 domain, Csk, Cbp, solution structure, TRANSFERASE-SIGNALING PROTEIN complex
Deposited on 2012-09-10, released 2013-04-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase CSK
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CSK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32577 (5-98)
      • expression tag (0-4)
    Domains in SCOPe 2.04: d2rsya_
  • Chain 'B':
    Compound: Phosphoprotein associated with glycosphingolipid-enriched microdomains 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Pag1, Cbp, Pag
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JM80 (4-37)
      • expression tag (0-3)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2rsyA (A:)
gplgsmpwfhgkitreqaerllyppetglflvrestnypgdytlcvscegkvehyrimyh
asklsideevyfenlmqlvehyttdadglctrlikpkvm

  • Chain 'B':
    No sequence available.