PDB entry 2rsy

View 2rsy on RCSB PDB site
Description: Solution structure of the SH2 domain of Csk in complex with a phosphopeptide from Cbp
Class: transferase/signaling protein
Keywords: SH2 domain, Csk, Cbp, solution structure, TRANSFERASE-SIGNALING PROTEIN complex
Deposited on 2012-09-10, released 2013-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tyrosine-protein kinase CSK
  Species: Rattus norvegicus [TaxId:10116]
  Gene: CSK
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32577 (5-98)
    • expression tag (0-4)
  Domains in SCOPe 2.08: d2rsya1, d2rsya2
• Chain 'B':
  Compound: Phosphoprotein associated with glycosphingolipid-enriched microdomains 1
  Species: Rattus norvegicus [TaxId:10116]
  Gene: Pag1, Cbp, Pag
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9JM80 (4-37)
    • expression tag (0-3)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rsyA (A:)
  gplgsmpwfhgkitreqaerllyppetglflvrestnypgdytlcvscegkvehyrimyh
  asklsideevyfenlmqlvehyttdadglctrlikpkvm
  

  
  
• Chain 'B':
  No sequence available.