PDB entry 2rsu

View 2rsu on RCSB PDB site
Description: Alternative structure of Ubiquitin
Class: protein binding
Keywords: ubiquitin, Q41N, high energy, N2, PROTEIN BINDING
Deposited on 2012-06-15, released 2013-03-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (0-75)
      • engineered mutation (40)
    Domains in SCOPe 2.08: d2rsua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rsuA (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqnrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg