PDB entry 2rst

View 2rst on RCSB PDB site
Description: NMR structure of the C-terminal domain of EW29
Class: sugar binding protein
Keywords: R-type lectin, SUGAR BINDING PROTEIN
Deposited on 2012-05-29, released 2013-04-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 29-kDa galactose-binding lectin
  Species: Lumbricus terrestris [TaxId:6398]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O96048 (1-131)
    • expression tag (0)
  Domains in SCOPe 2.08: d2rsta1, d2rsta2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rstA (A:)
  mkpkffyikselngkvldiegqnpapgskiitwdqkkgptavnqlwytdqqgvirsklnd
  faidasheqietqpfdpnnpkrawivsgntiaqlsdrdivldiiksdkeagahicawkqh
  ggpnqkfiiese