PDB entry 2rsq

View 2rsq on RCSB PDB site
Description: Copper(I) loaded form of the first domain of the human copper chaperone for SOD1, CCS
Class: metal binding protein
Keywords: copper chaperone, human CCS, human SOD1, METAL BINDING PROTEIN
Deposited on 2012-05-15, released 2013-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-03, with a file datestamp of 2013-03-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: copper chaperone for superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Gene: CCS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rsqa_
  • Heterogens: CU1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2rsqA (A:)
gsftmasdsgnqgtlctlefavqmtcqscvdavrkslqgvagvqdvevhledqmvlvhtt
lpsqevqallegtgrqavlkgmgsgqlqn

    Sequence, based on observed residues (ATOM records): (download) 
    >2rsqA (A:)
gtlctlefavqmtcqscvdavrkslqgvagvqdvevhledqmvlvhttlpsqevqalleg
tgrqavlkgmg