PDB entry 2rsp

View 2rsp on RCSB PDB site
Description: structure of the aspartic protease from rous sarcoma retrovirus refined at 2 angstroms resolution
Deposited on 1989-10-17, released 1989-10-17
The last revision prior to the SCOP 1.63 freeze date was dated 1991-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.144
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d2rspa_
  • Chain 'B':
    Domains in SCOP 1.63: d2rspb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rspA (A:)
    lamtmehkdrplvrviltntgshpvkqrsvyitalldsgaditiiseedwptdwpvmeaa
    npqihgigggipmrksrdmielgvinrdgslerplllfpavamvrgsilgrdclqglglr
    ltnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rspA (A:)
    lamtmehkdrplvrviltntgshpvkqrsvyitalldsgaditiiseedwptdwpvmeaa
    gipmrksrdmielgvinrdgslerplllfpavamvrgsilgrdclqglglrltnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rspB (B:)
    lamtmehkdrplvrviltntgshpvkqrsvyitalldsgaditiiseedwptdwpvmeaa
    npqihgigggipmrksrdmielgvinrdgslerplllfpavamvrgsilgrdclqglglr
    ltnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rspB (B:)
    lamtmehkdrplvrviltntgshpvkqrsvyitalldsgaditiiseedwptdwpvmegi
    pmrksrdmielgvinrdgslerplllfpavamvrgsilgrdclqglglrltnl