PDB entry 2rso

View 2rso on RCSB PDB site
Description: Solution structure of the chromodomain of Swi6
Deposited on 2012-04-18, released 2012-08-29
The last revision was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromatin-associated protein swi6
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: SWI6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40381 (4-91)
      • expression tag (0-3)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rsoA (A:)
    gshmeskssskklkenakeeeggeeeeedeyvvekvlkhrmarkgggyeyllkwegyddp
    sdntwsseadcsgckqlieaywnehggrpeps