PDB entry 2rsj

View 2rsj on RCSB PDB site
Description: Solution structures of the DNA-binding domains of immune-related zinc-finger protein ZFAT
Class: metal binding protein
Keywords: zfat, metal binding protein
Deposited on 2012-03-07, released 2013-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-03-13, with a file datestamp of 2013-03-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Zinc finger protein ZFAT
  Species: Homo sapiens [TaxId:9606]
  Gene: ZFAT, KIAA1485, ZFAT1, ZNF406
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9P243 (7-91)
    • expression tag (0-6)
  Domains in SCOPe 2.08: d2rsja1, d2rsja2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rsjA (A:)
  gssgssgkiftceycnkvfkfkhslqahlrihtnekpykcpqcsyasaikanlnvhlrkh
  tgekfacdycsftclskghlkvhiervhkkik