PDB entry 2rsf

View 2rsf on RCSB PDB site
Description: Complex structure of WWE in RNF146 with ATP
Class: ligase
Keywords: WWE domain, RNF146, Ubiquitin E3 ligase, LIGASE
Deposited on 2012-01-31, released 2013-03-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase RNF146
    Species: Mus musculus [TaxId:10090]
    Gene: RNF146
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CZW6 (7-103)
      • expression tag (0-6)
      • expression tag (104-109)
    Domains in SCOPe 2.08: d2rsfa1, d2rsfa2, d2rsfa3
  • Heterogens: ATP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2rsfA (A:)
pssgssgfldkptllspeelkaasrgngeyawyyegrngwwqydertsreledafskgkk
ntemliagflyvadlenmvqyrrnehgrrrkikrdiidipkkgvsgpssg