PDB entry 2rsc

View 2rsc on RCSB PDB site
Description: Solution Structure of the bombyx mori lysozyme
Class: hydrolase
Keywords: lysozyme, hydrolase
Deposited on 2011-12-19, released 2012-12-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-12-26, with a file datestamp of 2012-12-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lysozyme
  Species: Bombyx mori [TaxId:7091]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P48816 (1-119)
    • expression tag (0)
  Domains in SCOPe 2.08: d2rsca1, d2rsca2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rscA (A:)
  gktftrcglvhelrkhgfeenlmrnwvclvehessrdtsktntnrngskdyglfqindry
  wcskgaspgkdcnvkcsdlltdditkaakcakkiykrhrfdawygwknhcqgslpdissc