PDB entry 2rs9

View 2rs9 on RCSB PDB site
Description: solution structure of the bromodomain of human brpf1 in complex with histone h4k5ac peptide
Deposited on 2011-12-08, released 2012-12-12
The last revision was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetylated lysine 5 of peptide from Histone H4
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Peregrin
    Species: Homo sapiens [TaxId:9606]
    Gene: BRPF1, BR140
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55201 (7-114)
      • expression tag (0-6)
      • expression tag (115-120)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rs9A (A:)
    sgrgkggkgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2rs9B (B:)
    gssgssgflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleay
    rylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekmgsgpss
    g