PDB entry 2rs8

View 2rs8 on RCSB PDB site
Description: Solution structure of the N-terminal RNA recognition motif of NonO
Class: transcription
Keywords: RRM, RBD, RNP, TRANSCRIPTION, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2011-11-29, released 2012-12-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-12-19, with a file datestamp of 2012-12-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-POU domain-containing octamer-binding protein
    Species: Mus musculus [TaxId:10090]
    Gene: Nono
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99K48 (7-92)
      • expression tag (0-6)
      • expression tag (93-98)
    Domains in SCOPe 2.08: d2rs8a1, d2rs8a2, d2rs8a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rs8A (A:)
    gssgssggektftqrsrlfvgnlppditeeemrklfekygkagevfihkdkgfgfirlet
    rtlaeiakveldnmplrgkqlrvrfachsasltsgpssg