PDB entry 2rs7

View 2rs7 on RCSB PDB site
Description: Solution structure of the second dsRBD from RNA helicase A
Deposited on 2011-11-29, released 2012-03-14
The last revision was dated 2013-10-16, with a file datestamp of 2013-10-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent RNA helicase A
    Species: Mus musculus [TaxId:10090]
    Gene: Dhx9, Ddx9
    Database cross-references and differences (RAF-indexed):
    • Uniprot O70133 (7-106)
      • expression tag (0-6)
      • expression tag (107-112)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rs7A (A:)
gssgssgleseevdlnaglhgnwtlenakarlnqyfqkekiqgeykytqvgpdhnrsfia
emtiyikqlgrrifarehgsnkklaaqscalslvrqlyhlgvieayssgpssg