PDB entry 2rs5

View 2rs5 on RCSB PDB site
Description: structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Class: Virus
Keywords: RHINOVIRUS COAT PROTEIN, Icosahedral virus
Deposited on 1988-10-03, released 1990-01-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: human rhinovirus 14 coat protein (subunit vp1)
    Species: Human rhinovirus 14 [TaxId:12131]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rs51_
  • Chain '2':
    Compound: human rhinovirus 14 coat protein (subunit vp2)
    Species: Human rhinovirus 14 [TaxId:12131]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03303 (Start-261)
      • conflict (169)
    Domains in SCOPe 2.08: d2rs5.1
  • Chain '3':
    Compound: human rhinovirus 14 coat protein (subunit vp3)
    Species: Human rhinovirus 14 [TaxId:12131]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rs53_
  • Chain '4':
    Compound: human rhinovirus 14 coat protein (subunit vp4)
    Species: Human rhinovirus 14 [TaxId:12131]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rs5.1
  • Heterogens: W56, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >2rs51 (1:)
    glgdeleevivektkqtvasissgpkhtqkvpiltanetgatmpvlpsdsietrttymhf
    ngsetdvecflgraacvhvteiqnkdatgidnhreaklfndwkinlsslvqlrkklelft
    yvrfdseytilatasqpdsanyssnlvvqamyvppgapnpkewddytwqsasnpsvffkv
    gdtsrfsvpyvglasayncfydgyshddaetqygitvlnhmgsmafrivnehdehktlvk
    irvyhrakhveawiprapralpytsigrtnypkntepvikkrkgdiksy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rs51 (1:)
    tvasissgpkhtqkvpiltanetgatmpvlpsdsietrttymhfngsetdvecflgraac
    vhvteiqnkdatgidnhreaklfndwkinlsslvqlrkklelftyvrfdseytilatasq
    pdsanyssnlvvqamyvppgapnpkewddytwqsasnpsvffkvgdtsrfsvpyvglasa
    yncfydgyshddaetqygitvlnhmgsmafrivnehdehktlvkirvyhrakhveawipr
    apralpytsigrtnypkntepvikkrkgdiksy
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >2rs52 (2:)
    spnveacgysdrvqqitlgnstittqeaanavvcyaewpeylpdvdasdvnktskpdtsv
    crfytldsktwttgskgwcwklpdalkdmgvfgqnmffhslgrsgytvhvqcnatkfhsg
    cllvvvipehqlasheggnvsvkytfthpgergidlssanevggpvkdvlynmngtllgn
    llifphqfinlrtnntativipyinsvpidsmtrhnnvslmvipiapltvptgatpslpi
    tvtiapmctefsgirsksivpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rs52 (2:)
    gysdrvqqitlgnstittqeaanavvcyaewpeylpdvdasdvnktskpdtsvcrfytld
    sktwttgskgwcwklpdalkdmgvfgqnmffhslgrsgytvhvqcnatkfhsgcllvvvi
    pehqlasheggnvsvkytfthpgergidlssanevggpvkdvlynmngtllgnllifphq
    finlrtnntativipyinsvpidsmtrhnnvslmvipiapltvptgatpslpitvtiapm
    ctefsgirsksivpq
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rs53 (3:)
    glptttlpgsgqflttddrqspsalpnyeptprihipgkvhnlleiiqvdtlipmnntht
    kdevnsyliplnanrqneqvfgtnlfigdgvfkttllgeivqyythwsgslrfslmytgp
    alssaklilaytppgargpqdrreamlgthvvwdiglqstivmtipwtsgvqfrytdpdt
    ytsagflscwyqtslilppettgqvyllsfisacpdfklrlmkdtqtisqtvalte
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >2rs54 (4:)
    gaqvstqksgshenqniltngsnqtftvinyykdaastssagqslsmdpskftepvkdlm
    lkgapaln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rs54 (4:)
    inyykdaastssagqslsmdpskftepvkdlmlkgapaln