PDB entry 2rs4

View 2rs4 on RCSB PDB site
Description: NMR structure of stereo-array isotope labelled (SAIL) peptidyl-prolyl cis-trans isomerase from E. coli (EPPIb)
Class: isomerase
Keywords: sail, isomerase
Deposited on 2011-07-16, released 2011-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptidyl-prolyl cis-trans isomerase B
  Species: Escherichia coli [TaxId:83333]
  Gene: ppiB, b0525, JW0514
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23869 (0-163)
  Domains in SCOPe 2.07: d2rs4a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rs4A (A:)
  mvtfhtnhgdiviktfddkapetvknfldycregfynntifhrvingfmiqgggfepgmk
  qkatkepikneannglkntrgtlamartqaphsataqffinvvdndflnfsgeslqgwgy
  cvfaevvdgmdvvdkikgvatgrsgmhqdvpkedviiesvtvse