PDB entry 2rs4

View 2rs4 on RCSB PDB site
Description: NMR strucure of stereo-array isotope labelled (SAIL) peptidyl-prolyl cis-trans isomerase from E. coli (EPPIb)
Class: isomerase
Keywords: sail, isomerase
Deposited on 2011-07-16, released 2011-10-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase B
    Species: Escherichia coli [TaxId:83333]
    Gene: ppiB, b0525, JW0514
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2rs4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rs4A (A:)
    mvtfhtnhgdiviktfddkapetvknfldycregfynntifhrvingfmiqgggfepgmk
    qkatkepikneannglkntrgtlamartqaphsataqffinvvdndflnfsgeslqgwgy
    cvfaevvdgmdvvdkikgvatgrsgmhqdvpkedviiesvtvse