PDB entry 2rru

View 2rru on RCSB PDB site
Description: Solution structure of the UBA omain of p62 and its interaction with ubiquitin
Class: protein binding
Keywords: UBIQUITIN, UBA DOMAIN, P62/SQSTM1, Autophagy, PROTEIN BINDING
Deposited on 2011-06-09, released 2011-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-29, with a file datestamp of 2011-06-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sequestosome-1
    Species: Mus musculus [TaxId:10090]
    Gene: Sqstm1, A170, STAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64337 (5-52)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d2rrua1, d2rrua2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rruA (A:)
    gplgseadprlieslsqmlsmgfsdeggwltrllqtknydigaaldtiqyskh