PDB entry 2rrt

View 2rrt on RCSB PDB site
Description: Solution structure of Magnesium-bound form of calmodulin C-domain E104D/E140D mutant
Class: metal binding protein
Keywords: calmodulin, EF-hand, magnesium, Structural Genomics, PSI, Protein Structure Initiative, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN, NPPSFA, National Project on Protein Structural and Functional Analyses
Deposited on 2011-04-27, released 2011-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Xenopus laevis [TaxId:8355]
    Gene: calm1, calm2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62155 (1-71)
      • expression tag (0)
      • engineered mutation (27)
      • engineered mutation (63)
    Domains in SCOPe 2.08: d2rrta1, d2rrta2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rrtA (A:)
    mdtdseeeireafrvfdkdgngyisaadlrhvmtnlgekltdeevdemireadidgdgqv
    nyedfvqmmtak