PDB entry 2rrn

View 2rrn on RCSB PDB site
Description: Solution structure of SecDF periplasmic domain P4
Deposited on 2011-01-30, released 2011-05-18
The last revision was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable SecDF protein-export membrane protein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SKE6 (2-91)
      • initiating methionine (0)
      • expression tag (1)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rrnA (A:)
mvgfnysidftggtaytlraepnvevetlrrfleekgfpgkeavitqvqaptaayreflv
klpplsderrlelerlfaselkatvlasetvg