PDB entry 2rrm

View 2rrm on RCSB PDB site
Description: Interplay between phosphatidyl-inositol-phosphates and claudins upon binding to the 1st PDZ domain of zonula occludens 1
Class: Cell Adhesion
Keywords: PDZ Domain, protein protein interaction, tight junction protein 1, intercellular adhesion, Cell Adhesion
Deposited on 2011-01-06, released 2011-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tight junction protein ZO-1
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39447 (7-99)
    • expression tag (0-6)
  Domains in SCOPe 2.08: d2rrma1, d2rrma2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rrmA (A:)
  gplgsdhiweqhtvtlhrapgfgfgiaisggrdnphfqsgetsivisdvlkggpaegqlq
  endrvamvngvsmdnvehafavqqlrksgknakitirrkk