PDB entry 2rrl

View 2rrl on RCSB PDB site
Description: Solution structure of the C-terminal domain of the FliK
Deposited on 2011-01-02, released 2011-05-18
The last revision was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flagellar hook-length control protein
    Species: Salmonella typhimurium [TaxId:90371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26416 (2-168)
      • expression tag (0-1)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rrlA (A:)
hmasddratgpaltplvvaaaatsakvevdsppapvthgaamptlssataqplpvasapv
lsaplgshewqqtfsqqvmlftrqgqqsaqlrlhpeelgqvhislklddnqaqlqmvsph
shvraaleaalpmlrtqlaesgiqlgqssissesfagqqqsssqqqssr