PDB entry 2rrk

View 2rrk on RCSB PDB site
Description: Solution structure of the E. coli ORF135 protein
Class: hydrolase
Keywords: pyrophospho hydrolase, HYDROLASE
Deposited on 2011-01-01, released 2012-01-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: CTP pyrophosphohydrolase
  Species: Escherichia coli [TaxId:83333]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P77788 (5-139)
    • expression tag (0-4)
  Domains in SCOPe 2.08: d2rrka1, d2rrka2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rrkA (A:)
  gplgsmkmievvaaiierdgkillaqrpaqsdqaglwefaggkvepdesqrqalvrelre
  elgieatvgeyvashqrevsgriihlhawhvpdfhgtlqahehqalvwcspeealqypla
  padiplleafmalraarpad