PDB entry 2rrf

View 2rrf on RCSB PDB site
Description: the solution structure of the c-terminal region of zinc finger fyve domain-containing protein 21
Deposited on 2010-08-03, released 2011-08-03
The last revision was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger FYVE domain-containing protein 21
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BQ24 (7-134)
      • expression tag (0-6)
      • expression tag (135-140)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rrfA (A:)
gssgssgaefydkqlkvllsgatflvtfgnsekpetmtcrlsnnqrylfldgdshyeiei
vhistvqiltegfppgggnaratgmflqytvpgtegvtqlkltvvedvtvgrrqavawlv
amhkaakllyesrdqsgpssg